PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G132600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 360aa    MW: 38343.3 Da    PI: 6.1656
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G132600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21e-141461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++lv  +   G  +W+++++  g+ R++k+c++rw +yl
  Sobic.007G132600.1.p 14 KGPWTAEEDQKLVSFILGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                          79******************************99************97 PP

2Myb_DNA-binding53.55.4e-1771111547
                           -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +  E++l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Sobic.007G132600.1.p  71 SDAEEKLVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                           778***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-19562IPR009057Homeodomain-like
PROSITE profilePS5129414.15961IPR017930Myb domain
SuperFamilySSF466895.99E-2611108IPR009057Homeodomain-like
SMARTSM007174.7E-111363IPR001005SANT/Myb domain
PfamPF002493.3E-131461IPR001005SANT/Myb domain
PROSITE profilePS5129426.83362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2463117IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002491.1E-1471111IPR001005SANT/Myb domain
CDDcd001671.06E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFIL GNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDAEEKLVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPLTHKPLC PSSSSSSSSA DPQQLQSPPP TAATGGSTEA QAAQPSPSPP SRKPPEQKTA  180
AAPVTTPPPA ATIAASRQEL AGDDADGLLL SNSDPGFCTD EVPMMHPDEI MVPVLGDQRL  240
HTPPLPTFSP ATAAAAAAAV STTPTTTTSS SAAASAASSS SLISRDEDAA LFPLIDMDFP  300
EIVFRMGLDD MVASWDDSLA QPPLSPSLPV YEDSAYQLQR SGVAFDQEPG NKIQLFSSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0362290.0BT036229.1 Zea mays full-length cDNA clone ZM_BFb0101M11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444373.11e-168hypothetical protein SORBIDRAFT_07g020880
TrEMBLC5YL361e-168C5YL36_SORBI; Putative uncharacterized protein Sb07g020880
STRINGSb07g020880.11e-167(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-88myb domain protein 20